Catalogue number
PRO-367
Synonyms
MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.
Introduction
MICA (MHC class I chain-related gene A) is a transmembrane glycoprotein that functions as a ligand for human NKG2D. A closely related protein, MICB, shares 85% amino acid identity with MICA. These proteins are distantly related to the MHC class I proteins. They possess three extracellular Ig-like domains, but they have no capacity to bind peptide or interact with ?2-microglobulin. The genes encoding these proteins are found within the Major Histocompatibility Complex on human chromosome 6. The MICA locus is highly polymorphic with more than 50 recognized human alleles. MICA is absent from most cells but is frequently expressed in epithelial tumors and can be induced by bacterial and viral infections. MICA is a ligand for human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma delta T cells, and CD8+ beta T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MICA recognition is involved in tumor surveillance, viral infections, and autoimmune diseases.
Description
MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa.
The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 – Gln308) The MICA is purified by proprietary chromatographic techniques.
Source
Escherichia Coli.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility
It is recommended to reconstitute the lyophilized MICA in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability
Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MICA should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Amino acid sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQE
IRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAM
NVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVN
VTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLP
DGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.
Biological Activity
Measured by its ability to bind MICA antibody in ELISA.
References
1.Title:Therapy-induced antibodies to MHC class I chain-related protein A antagonize immune suppression and stimulate antitumor cytotoxicity.
Publication:PNAS June 13, 2006 vol. 103 no. 24 9191
Link:http://www.pnas.org/content/103/24/9190.full.pdf
2.Title:MHC class I chain-related protein A antibodies and shedding are associated with the progression of multiple myeloma.
Publication:Published online before print January 17, 2008, doi: 10.1073/pnas.0711293105 PNAS January 29, 2008 vol. 105 no. 4 1285-1290
Link:http://www.pnas.org/content/105/4/1285.full
Safety Data Sheet
Usage
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
